MARVELD3 antibody (Middle Region)

Catalog No. ABIN634967

The Rabbit Polyclonal anti-MARVELD3 antibody has been validated for WB and IHC. It is suitable to detect MARVELD3 in samples from Human, Mouse and Dog.

Quick Overview for MARVELD3 antibody (Middle Region) (ABIN634967)

Target: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MARVELD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MARVELD3 Antibody

Binding Specificity: Middle Region

Specificity: MARVELD3 antibody was raised against the middle region of MARVELD3

Purification: Affinity purified

Immunogen: MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MARVELD3 Blocking Peptide, (ABIN5614674), is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MARVELD3

Target: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Alternative Name: MARVELD3

Background: MARVELD3 is involved in membrane apposition and fusion events.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization