LRRN3 antibody (N-Term)

Catalog No. ABIN634977

This anti-LRRN3 antibody is a Rabbit Polyclonal antibody detecting LRRN3 in WB. Suitable for Human.

Quick Overview for LRRN3 antibody (N-Term) (ABIN634977)

Target: LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRN3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRN3 Antibody

Binding Specificity: N-Term

Specificity: LRRN3 antibody was raised against the N terminal of LRRN3

Purification: Affinity purified

Immunogen: LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRN3 Blocking Peptide, (ABIN937968), is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRN3

Target: LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))

Alternative Name: LRRN3

Background: LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.

Molecular Weight: 79 kDa (MW of target protein)