TMEM195 antibody (Middle Region)

Catalog No. ABIN635006

The Rabbit Polyclonal anti-TMEM195 antibody has been validated for WB. It is suitable to detect TMEM195 in samples from Human.

Quick Overview for TMEM195 antibody (Middle Region) (ABIN635006)

Target: TMEM195 (Transmembrane Protein 195 (TMEM195))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM195 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM195 Antibody

Binding Specificity: Middle Region

Specificity: TMEM195 antibody was raised against the middle region of TMEM195

Purification: Affinity purified

Immunogen: TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM195 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM195

Target: TMEM195 (Transmembrane Protein 195 (TMEM195))

Alternative Name: TMEM195

Background: TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.

Molecular Weight: 51 kDa (MW of target protein)