SLC25A31 antibody

Catalog No. ABIN635043

This anti-SLC25A31 antibody is a Rabbit Polyclonal antibody detecting SLC25A31 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SLC25A31 antibody (ABIN635043)

Target: SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A31 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A31 Antibody

Purification: Affinity purified

Immunogen: SLC25 A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A31 Blocking Peptide, catalog no. 33R-4767, is also available for use as a blocking control in assays to test for specificity of this SLC25A31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A31

Target: SLC25A31 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 31 (SLC25A31))

Alternative Name: SLC25A31

Background: Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase against ADP produced in cytosol by most energy-consuming reactions.

Molecular Weight: 35 kDa (MW of target protein)