GPRC5A antibody (C-Term)
-
- Target See all GPRC5A Antibodies
- GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPRC5A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPCR5 A antibody was raised against the C terminal Of Gpcr5
- Purification
- Affinity purified
- Immunogen
- GPCR5 A antibody was raised using the C terminal Of Gpcr5 corresponding to a region with amino acids SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY
- Top Product
- Discover our top product GPRC5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPCR5A Blocking Peptide, catalog no. 33R-8711, is also available for use as a blocking control in assays to test for specificity of this GPCR5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPCR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPRC5A (G Protein-Coupled Receptor, Family C, Group 5, Member A (GPRC5A))
- Alternative Name
- GPCR5A (GPRC5A Products)
- Background
- GPCR5A is a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. Its gene may play a role in embryonic development and epithelial cell differentiation.
- Molecular Weight
- 39 kDa (MW of target protein)
-