DIRC2 antibody (Middle Region)

Catalog No. ABIN635117

The Rabbit Polyclonal anti-DIRC2 antibody has been validated for WB. It is suitable to detect DIRC2 in samples from Human and Mouse.

Quick Overview for DIRC2 antibody (Middle Region) (ABIN635117)

Target: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DIRC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DIRC2 Antibody

Binding Specificity: Middle Region

Specificity: DIRC2 antibody was raised against the middle region of DIRC2

Purification: Affinity purified

Immunogen: DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DIRC2 Blocking Peptide, (ABIN936149), is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DIRC2

Target: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Alternative Name: DIRC2

Background: DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.

Molecular Weight: 52 kDa (MW of target protein)