-
- Target See all DLG3 Antibodies
- DLG3 (Discs, Large Homolog 3 (DLG3))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLG3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG
- Top Product
- Discover our top product DLG3 Primary Antibody
-
anti-Discs, Large Homolog 3 (DLG3) (AA 501-600) antibody
DLG3 Reactivity: Human, Rat WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 281-380) antibodyDLG3 Reactivity: Human WB, ELISA, RNAi Host: Mouse Monoclonal 2B6 unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 1-817) antibodyDLG3 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 464-817) antibodyDLG3 Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 749-817) antibodyDLG3 Reactivity: Rat, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 648-697) antibodyDLG3 Reactivity: Human, Rat, Mouse, Cow, Guinea Pig, Rabbit, Dog, Horse, Zebrafish (Danio rerio), Pig, Monkey, Chicken WB Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 201-250) antibodyDLG3 Reactivity: Human, Rat, Mouse, Cow, Guinea Pig, Rabbit, Horse, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 108-157) antibodyDLG3 Reactivity: Human, Rat, Mouse, Cow, Guinea Pig, Rabbit, Dog, Zebrafish (Danio rerio), Pig, Monkey, Bat, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 58-107) antibodyDLG3 Reactivity: Human, Rat, Mouse, Cow, Guinea Pig, Rabbit, Pig, Monkey, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Discs, Large Homolog 3 (DLG3) (AA 14-26) antibodyDLG3 Reactivity: Human, Rat, Mouse, Hamster WB, ICC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLG3 Blocking Peptide, catalog no. 33R-3722, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLG3 (Discs, Large Homolog 3 (DLG3))
- Alternative Name
- DLG3 (DLG3 Products)
- Background
- DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
- Molecular Weight
- 58 kDa (MW of target protein)
-
You are here:
