DLG3 antibody

Catalog No. ABIN635177

The Rabbit Polyclonal anti-DLG3 antibody has been validated for WB. It is suitable to detect DLG3 in samples from Human, Rat and Mouse.

Quick Overview for DLG3 antibody (ABIN635177)

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DLG3 Antibody

Purification: Affinity purified

Immunogen: DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLG3 Blocking Peptide, (ABIN939108), is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLG3

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Alternative Name: DLG3

Background: DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).

Molecular Weight: 58 kDa (MW of target protein)