IL18R1 antibody (N-Term)

Catalog No. ABIN635200

Product Details anti-IL18R1 Antibody

Target: IL18R1 (Interleukin 18 Receptor 1 (IL18R1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL18R1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL18 R1 antibody was raised against the N terminal of IL18 1

Purification: Affinity purified

Immunogen: IL18 R1 antibody was raised using the N terminal of IL18 1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL18R1 Blocking Peptide, catalog no. 33R-7090, is also available for use as a blocking control in assays to test for specificity of this IL18R1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL18R1

Target: IL18R1 (Interleukin 18 Receptor 1 (IL18R1))

Alternative Name: IL18R1 (IL18R1 Products)

Background: The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction.

Molecular Weight: 60 kDa (MW of target protein)