FMO5 antibody (Middle Region)

Catalog No. ABIN635212

This Rabbit Polyclonal antibody specifically detects FMO5 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for FMO5 antibody (Middle Region) (ABIN635212)

Target: FMO5 (Flavin Containing Monooxygenase 5 (FMO5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMO5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FMO5 Antibody

Binding Specificity: Middle Region

Specificity: FMO5 antibody was raised against the middle region of FMO5

Purification: Affinity purified

Immunogen: FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FMO5 Blocking Peptide, (ABIN5613625), is also available for use as a blocking control in assays to test for specificity of this FMO5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FMO5

Target: FMO5 (Flavin Containing Monooxygenase 5 (FMO5))

Alternative Name: FMO5

Background: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity.

Molecular Weight: 59 kDa (MW of target protein)