FMO5 antibody (Middle Region)
-
- Target See all FMO5 Antibodies
- FMO5 (Flavin Containing Monooxygenase 5 (FMO5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FMO5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FMO5 antibody was raised against the middle region of FMO5
- Purification
- Affinity purified
- Immunogen
- FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN
- Top Product
- Discover our top product FMO5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FMO5 Blocking Peptide, catalog no. 33R-6751, is also available for use as a blocking control in assays to test for specificity of this FMO5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FMO5 (Flavin Containing Monooxygenase 5 (FMO5))
- Alternative Name
- FMO5 (FMO5 Products)
- Background
- Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity.
- Molecular Weight
- 59 kDa (MW of target protein)
-