TMEM93 antibody (N-Term)

Catalog No. ABIN635215

This Rabbit Polyclonal antibody specifically detects TMEM93 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMEM93 antibody (N-Term) (ABIN635215)

Target: TMEM93 (Transmembrane Protein 93 (TMEM93))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM93 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM93 Antibody

Binding Specificity: N-Term

Specificity: TMEM93 antibody was raised against the N terminal of TMEM93

Purification: Affinity purified

Immunogen: TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM93 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM93

Target: TMEM93 (Transmembrane Protein 93 (TMEM93))

Alternative Name: TMEM93

Background: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

Molecular Weight: 12 kDa (MW of target protein)