TCTN3 antibody (Middle Region)

Catalog No. ABIN635221

This Rabbit Polyclonal antibody specifically detects TCTN3 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for TCTN3 antibody (Middle Region) (ABIN635221)

Target: TCTN3 (Tectonic Family Member 3 (TCTN3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCTN3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TCTN3 Antibody

Binding Specificity: Middle Region

Specificity: TCTN3 antibody was raised against the middle region of TCTN3

Purification: Affinity purified

Immunogen: TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCTN3 Blocking Peptide, (ABIN5616545), is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCTN3

Target: TCTN3 (Tectonic Family Member 3 (TCTN3))

Alternative Name: TCTN3

Background: TCTN3 may be involved in apoptosis regulation.

Molecular Weight: 64 kDa (MW of target protein)