Transferrin Receptor 2 antibody (N-Term)

Catalog No. ABIN635270

The Rabbit Polyclonal anti-Transferrin Receptor 2 antibody has been validated for WB. It is suitable to detect Transferrin Receptor 2 in samples from Human, Mouse and Rat.

Quick Overview for Transferrin Receptor 2 antibody (N-Term) (ABIN635270)

Target: Transferrin Receptor 2 (TFR2)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Transferrin Receptor 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Transferrin Receptor 2 Antibody

Binding Specificity: N-Term

Specificity: TFR2 antibody was raised against the N terminal of TFR2

Purification: Affinity purified

Immunogen: TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TFR2 Blocking Peptide, (ABIN5616572), is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Transferrin Receptor 2

Target: Transferrin Receptor 2 (TFR2)

Alternative Name: TFR2

Background: TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis