ABCC11 antibody (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11)

Details for Product anti-ABCC11 Antibody No. ABIN635292
Target
Reactivity
Human
47
4
3
2
2
1
1
1
1
Host
Rabbit
38
6
3
1
Clonality
Polyclonal
Conjugate
This ABCC11 antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
40
26
23
5
4
2
2
2
2
Options
Immunogen ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Purification Affinity purified
Target
Alternative Name ABCC11 (ABCC11 Antibody Abstract)
Background The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
Molecular Weight 154 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

ABCC11 Blocking Peptide, catalog no. 33R-6880, is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC11 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11) antibody (ABIN635292) ABCC11 antibody used at 1 ug/ml to detect target protein.