ABCC11 antibody
-
- Target See all ABCC11 Antibodies
- ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCC11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
- Top Product
- Discover our top product ABCC11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCC11 Blocking Peptide, catalog no. 33R-6880, is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))
- Alternative Name
- ABCC11 (ABCC11 Products)
- Synonyms
- EWWD antibody, MRP8 antibody, WW antibody, ATP binding cassette subfamily C member 11 antibody, ABCC11 antibody
- Background
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
- Molecular Weight
- 154 kDa (MW of target protein)
-