Podoplanin antibody (Middle Region)

Catalog No. ABIN635390

The Rabbit Polyclonal anti-Podoplanin antibody has been validated for WB. It is suitable to detect Podoplanin in samples from Human.

Quick Overview for Podoplanin antibody (Middle Region) (ABIN635390)

Target: Podoplanin (PDPN)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Podoplanin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Podoplanin Antibody

Binding Specificity: Middle Region

Specificity: Podoplanin antibody was raised against the middle region of PDPN

Purification: Affinity purified

Immunogen: Podoplanin antibody was raised using the middle region of PDPN corresponding to a region with amino acids VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Podoplanin Blocking Peptide, (ABIN5615446), is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Podoplanin

Target: Podoplanin (PDPN)

Alternative Name: Podoplanin

Background: PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport