KLRC3 antibody (N-Term)

Catalog No. ABIN635416

This Rabbit Polyclonal antibody specifically detects KLRC3 in WB. It exhibits reactivity toward Human.

Quick Overview for KLRC3 antibody (N-Term) (ABIN635416)

Target: KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLRC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KLRC3 Antibody

Binding Specificity: N-Term

Specificity: KLRC3 antibody was raised against the N terminal of KLRC3

Purification: Affinity purified

Immunogen: KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLRC3 Blocking Peptide, (ABIN5614394), is also available for use as a blocking control in assays to test for specificity of this KLRC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLRC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLRC3

Target: KLRC3 (Killer Cell Lectin-Like Receptor Subfamily C, Member 3 (KLRC3))

Alternative Name: KLRC3

Background: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity.

Molecular Weight: 27 kDa (MW of target protein)