Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RHBDL2 antibody (Rhomboid, Veinlet-Like 2) Primary Antibody

RHBDL2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635453
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    RHBDL2
    Reactivity
    • 24
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Human
    Host
    • 20
    • 4
    Rabbit
    Clonality
    • 22
    • 2
    Polyclonal
    Conjugate
    • 11
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This RHBDL2 antibody is un-conjugated
    Application
    • 15
    • 12
    • 3
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogen
    RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    RHBDL2 Blocking Peptide, catalog no. 33R-4732, is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDL2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    RHBDL2
    Alternative Name
    RHBDL2 (RHBDL2 Antibody Abstract)
    Synonyms
    RRP2, 9130416B15, rhomboid like 2, rhomboid, veinlet-like 2 (Drosophila), RHBDL2, Rhbdl2
    Background
    RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.
    Molecular Weight
    34 kDa (MW of target protein)
You are here:
help Support