Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RHBDL2 antibody (Rhomboid, Veinlet-Like 2) (AA 1-72) Primary Antibody

RHBDL2 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 2H1 unconjugated
Catalog No. ABIN527259
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    RHBDL2
    Binding Specificity
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    AA 1-72
    Reactivity
    • 24
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Human
    Host
    • 21
    • 3
    Mouse
    Clonality
    • 23
    • 1
    Monoclonal
    Conjugate
    • 11
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This RHBDL2 antibody is un-conjugated
    Application
    • 15
    • 11
    • 3
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant RHBDL2.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: RHBDL2 (NP_060291.2, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP

    Clone
    2H1
    Isotype
    IgG2b kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    RHBDL2
    Alternative Name
    RHBDL2 (RHBDL2 Antibody Abstract)
    Synonyms
    RRP2, 9130416B15, rhomboid like 2, rhomboid, veinlet-like 2 (Drosophila), RHBDL2, Rhbdl2
    Background
    Full Gene Name: rhomboid, veinlet-like 2 (Drosophila)
    Synonyms: MGC16997,RRP2
    Gene ID
    54933
    NCBI Accession
    NP_060291, NM_017821
You are here:
help Support