HLC8 antibody (N-Term)

Catalog No. ABIN635456

The Rabbit Polyclonal anti-HLC8 antibody has been validated for WB. It is suitable to detect HLC8 in samples from Human.

Quick Overview for HLC8 antibody (N-Term) (ABIN635456)

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HLC8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HLC8 Antibody

Binding Specificity: N-Term

Specificity: C17 ORF80 antibody was raised against the N terminal Of C17 rf80

Purification: Affinity purified

Immunogen: C17 ORF80 antibody was raised using the N terminal Of C17 rf80 corresponding to a region with amino acids MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF80 Blocking Peptide, (ABIN5612429), is also available for use as a blocking control in assays to test for specificity of this C17ORF80 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HLC8

Target: HLC8 (C17orf80) (Chromosome 17 Open Reading Frame 80 (C17orf80))

Alternative Name: C17ORF80

Background: The function of C17orf80 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 67 kDa (MW of target protein)