MGC4172 (Middle Region) antibody

Catalog No. ABIN635482

This Rabbit Polyclonal antibody specifically detects in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MGC4172 (Middle Region) antibody (ABIN635482)

Target: MGC4172

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: MGC4172 antibody was raised against the middle region of MGC4172

Purification: Affinity purified

Immunogen: MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC4172 Blocking Peptide, (ABIN937337), is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC4172 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: MGC4172

Background: The function of MGC4172 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 28 kDa (MW of target protein)