ATP4b antibody (Middle Region)
-
- Target See all ATP4b Antibodies
- ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP4b antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP4 B antibody was raised against the middle region of ATP4
- Purification
- Affinity purified
- Immunogen
- ATP4 B antibody was raised using the middle region of ATP4 corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK
- Top Product
- Discover our top product ATP4b Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP4B Blocking Peptide, catalog no. 33R-7776, is also available for use as a blocking control in assays to test for specificity of this ATP4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))
- Alternative Name
- ATP4B (ATP4b Products)
- Background
- ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Proton Transport
-