Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2) (Middle Region) antibody Primary Antibody

MAN1A2 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635557
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2)
    Binding Specificity
    • 3
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 9
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 8
    • 1
    Rabbit
    Clonality
    • 9
    Polyclonal
    Application
    • 9
    • 3
    • 2
    • 1
    Western Blotting (WB)
    Specificity
    MAN1 A2 antibody was raised against the middle region of MAN1 2
    Purification
    Affinity purified
    Immunogen
    MAN1 A2 antibody was raised using the middle region of MAN1 2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    MAN1A2 Blocking Peptide, catalog no. 33R-2844, is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAN0 2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2)
    Alternative Name
    MAN1A2 (MAN1A2 Antibody Abstract)
    Synonyms
    man1b, MAN1B, AI428775, AI528764, AI854422, Man1b, PCR2, mannosidase, alpha, class 1A, member 2 L homeolog, mannosidase alpha class 1A member 2, mannosidase, alpha, class 1A, member 2, man1a2.L, MAN1A2, Man1a2
    Background
    Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.
    Molecular Weight
    73 kDa (MW of target protein)
You are here:
help Support