MAN1A2 antibody (Middle Region)
-
- Target See all MAN1A2 Antibodies
- MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAN1A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAN1 A2 antibody was raised against the middle region of MAN1 2
- Purification
- Affinity purified
- Immunogen
- MAN1 A2 antibody was raised using the middle region of MAN1 2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE
- Top Product
- Discover our top product MAN1A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAN1A2 Blocking Peptide, catalog no. 33R-2844, is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAN0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))
- Alternative Name
- MAN1A2 (MAN1A2 Products)
- Synonyms
- man1b antibody, MAN1B antibody, AI428775 antibody, AI528764 antibody, AI854422 antibody, Man1b antibody, PCR2 antibody, mannosidase, alpha, class 1A, member 2 L homeolog antibody, mannosidase alpha class 1A member 2 antibody, mannosidase, alpha, class 1A, member 2 antibody, man1a2.L antibody, MAN1A2 antibody, Man1a2 antibody
- Background
- Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.
- Molecular Weight
- 73 kDa (MW of target protein)
-