PLP1 antibody (Middle Region)

Catalog No. ABIN635575

This Rabbit Polyclonal antibody specifically detects PLP1 in WB. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for PLP1 antibody (Middle Region) (ABIN635575)

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLP1 Antibody

Binding Specificity: Middle Region

Specificity: PLP1 antibody was raised against the middle region of PLP1

Purification: Affinity purified

Immunogen: PLP1 antibody was raised using the middle region of PLP1 corresponding to a region with amino acids IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLP1 Blocking Peptide, (ABIN939605), is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLP1

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Alternative Name: PLP1

Background: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.

Molecular Weight: 30 kDa (MW of target protein)