PILRA antibody (N-Term)
-
- Target See all PILRA Antibodies
- PILRA (Paired Immunoglobin-Like Type 2 Receptor alpha (PILRA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PILRA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PILRA antibody was raised against the N terminal of PILRA
- Purification
- Affinity purified
- Immunogen
- PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN
- Top Product
- Discover our top product PILRA Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PILRA Blocking Peptide, catalog no. 33R-4090, is also available for use as a blocking control in assays to test for specificity of this PILRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PILRA (Paired Immunoglobin-Like Type 2 Receptor alpha (PILRA))
- Alternative Name
- PILRA (PILRA Products)
- Background
- Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role.
- Molecular Weight
- 18 kDa (MW of target protein)
-