ZDHHC14 antibody (N-Term)

Catalog No. ABIN635620

This Rabbit Polyclonal antibody specifically detects ZDHHC14 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ZDHHC14 antibody (N-Term) (ABIN635620)

Target: ZDHHC14 (Zinc Finger, DHHC-Type Containing 14 (ZDHHC14))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZDHHC14 Antibody

Binding Specificity: N-Term

Specificity: ZDHHC14 antibody was raised against the N terminal of ZDHHC14

Purification: Affinity purified

Immunogen: ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC14 Blocking Peptide, catalog no. 33R-9176, is also available for use as a blocking control in assays to test for specificity of this ZDHHC14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC14

Target: ZDHHC14 (Zinc Finger, DHHC-Type Containing 14 (ZDHHC14))

Alternative Name: ZDHHC14

Background: ZDHHC14 belongs to the DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily. It contains 1 DHHC-type zinc finger. It is a multi-pass membrane protein. The function of ZDHHC14 remains unknown.

Molecular Weight: 53 kDa (MW of target protein)