YIPF6 antibody (C-Term)

Catalog No. ABIN635621

The Rabbit Polyclonal anti-YIPF6 antibody has been validated for WB. It is suitable to detect YIPF6 in samples from Human.

Quick Overview for YIPF6 antibody (C-Term) (ABIN635621)

Target: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YIPF6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-YIPF6 Antibody

Binding Specificity: C-Term

Specificity: YIPF6 antibody was raised against the C terminal of YIPF6

Purification: Affinity purified

Immunogen: YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YIPF6 Blocking Peptide, (ABIN5617059), is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YIPF6

Target: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Alternative Name: YIPF6

Background: YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.

Molecular Weight: 26 kDa (MW of target protein)