TMEM63A antibody (N-Term)

Catalog No. ABIN635671

This Rabbit Polyclonal antibody specifically detects TMEM63A in WB. It exhibits reactivity toward Human.

Quick Overview for TMEM63A antibody (N-Term) (ABIN635671)

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM63A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM63A Antibody

Binding Specificity: N-Term

Specificity: TMEM63 A antibody was raised against the N terminal of TMEM63

Purification: Affinity purified

Immunogen: TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM63A Blocking Peptide, (ABIN5616685), is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM63A

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Alternative Name: TMEM63A

Background: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Molecular Weight: 89 kDa (MW of target protein)