IGHV5-2 antibody (N-Term)

Catalog No. ABIN635673

This anti-IGHV5-2 antibody is a Rabbit Polyclonal antibody detecting IGHV5-2 in WB. Suitable for Human.

Quick Overview for IGHV5-2 antibody (N-Term) (ABIN635673)

Target: IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-IGHV5-2 Antibody

Binding Specificity: N-Term

Specificity: PIGZ antibody was raised against the N terminal of PIGZ

Purification: Affinity purified

Immunogen: PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGZ Blocking Peptide, (ABIN5615374), is also available for use as a blocking control in assays to test for specificity of this PIGZ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGHV5-2

Target: IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))

Alternative Name: IGZ

Background: The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.

Molecular Weight: 63 kDa (MW of target protein)