SEMA4B antibody (N-Term)
-
- Target See all SEMA4B Antibodies
- SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SEMA4B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SEMA4 B antibody was raised against the N terminal of SEMA4
- Purification
- Affinity purified
- Immunogen
- SEMA4 B antibody was raised using the N terminal of SEMA4 corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS
- Top Product
- Discover our top product SEMA4B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SEMA4B Blocking Peptide, catalog no. 33R-4404, is also available for use as a blocking control in assays to test for specificity of this SEMA4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))
- Alternative Name
- SEMA4B (SEMA4B Products)
- Background
- SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
- Molecular Weight
- 93 kDa (MW of target protein)
-