DNASE2B antibody (N-Term)

Catalog No. ABIN635735

The Rabbit Polyclonal anti-DNASE2B antibody has been validated for WB. It is suitable to detect DNASE2B in samples from Human.

Quick Overview for DNASE2B antibody (N-Term) (ABIN635735)

Target: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNASE2B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNASE2B Antibody

Binding Specificity: N-Term

Specificity: DNASE2 B antibody was raised against the N terminal of DNASE2

Purification: Affinity purified

Immunogen: DNASE2 B antibody was raised using the N terminal of DNASE2 corresponding to a region with amino acids EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNASE2B Blocking Peptide, catalog no. 33R-2433, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNASE2B

Target: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Alternative Name: DNASE2B

Background: DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.

Molecular Weight: 39 kDa (MW of target protein)