LRRTM1 antibody (Middle Region)

Catalog No. ABIN635752

This Rabbit Polyclonal antibody specifically detects LRRTM1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LRRTM1 antibody (Middle Region) (ABIN635752)

Target: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRTM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRTM1 Antibody

Binding Specificity: Middle Region

Specificity: LRRTM1 antibody was raised against the middle region of LRRTM1

Purification: Affinity purified

Immunogen: LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRTM1 Blocking Peptide, (ABIN5614592), is also available for use as a blocking control in assays to test for specificity of this LRRTM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRTM1

Target: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))

Alternative Name: LRRTM1

Background: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: Synaptic Membrane