TMEM35 antibody (C-Term)

Catalog No. ABIN635766

This anti-TMEM35 antibody is a Rabbit Polyclonal antibody detecting TMEM35 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TMEM35 antibody (C-Term) (ABIN635766)

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM35 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM35 Antibody

Binding Specificity: C-Term

Specificity: TMEM35 antibody was raised against the C terminal of TMEM35

Purification: Affinity purified

Immunogen: TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM35 Blocking Peptide, (ABIN5616678), is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM35

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Alternative Name: TMEM35

Background: TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.

Molecular Weight: 18 kDa (MW of target protein)