HAVCR1 antibody (N-Term)

Catalog No. ABIN635773

This Rabbit Polyclonal antibody specifically detects HAVCR1 in WB. It exhibits reactivity toward Hepatitis A Virus (HAV).

Quick Overview for HAVCR1 antibody (N-Term) (ABIN635773)

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Reactivity: Hepatitis A Virus (HAV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAVCR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HAVCR1 Antibody

Binding Specificity: N-Term

Specificity: HAVCR1 antibody was raised against the N terminal of HAVCR1

Purification: Affinity purified

Immunogen: HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAVCR1 Blocking Peptide, (ABIN937102), is also available for use as a blocking control in assays to test for specificity of this HAVCR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAVCR1

Target: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Alternative Name: HAVCR1

Target Type: Virus

Background: HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.

Molecular Weight: 39 kDa (MW of target protein)