FZD6 antibody

Catalog No. ABIN635881

This Rabbit Polyclonal antibody specifically detects FZD6 in WB. It exhibits reactivity toward Human.

Quick Overview for FZD6 antibody (ABIN635881)

Target: FZD6 (Frizzled Family Receptor 6 (FZD6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FZD6 Antibody

Purification: Affinity purified

Immunogen: FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD6 Blocking Peptide, (ABIN939150), is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD6

Target: FZD6 (Frizzled Family Receptor 6 (FZD6))

Alternative Name: FZD6

Background: This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Molecular Weight: 79 kDa (MW of target protein)

Pathways: WNT Signaling, Tube Formation