SRD5A2 antibody (N-Term)

Catalog No. ABIN635902

This Rabbit Polyclonal antibody specifically detects SRD5A2 in WB. It exhibits reactivity toward Human.

Quick Overview for SRD5A2 antibody (N-Term) (ABIN635902)

Target: SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRD5A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SRD5A2 Antibody

Binding Specificity: N-Term

Specificity: SRD5 A2 antibody was raised against the N terminal of SRD5 2

Purification: Affinity purified

Immunogen: SRD5 A2 antibody was raised using the N terminal of SRD5 2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRD5A2 Blocking Peptide, (ABIN5616388), is also available for use as a blocking control in assays to test for specificity of this SRD5A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRD5A2

Target: SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))

Alternative Name: SRD5A2

Background: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis