GOLM1 antibody (N-Term)

Catalog No. ABIN635986

This Rabbit Polyclonal antibody specifically detects GOLM1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GOLM1 antibody (N-Term) (ABIN635986)

Target: GOLM1 (Golgi Membrane Protein 1 (GOLM1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOLM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GOLM1 Antibody

Binding Specificity: N-Term

Specificity: GOLM1 antibody was raised against the N terminal of GOLM1

Purification: Affinity purified

Immunogen: GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOLM1 Blocking Peptide, (ABIN5613820), is also available for use as a blocking control in assays to test for specificity of this GOLM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOLM1

Target: GOLM1 (Golgi Membrane Protein 1 (GOLM1))

Alternative Name: GOLM1

Background: GOLM1 is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Molecular Weight: 45 kDa (MW of target protein)