FLJ20674 (N-Term) antibody

Catalog No. ABIN636000

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB. Suitable for Human, Mouse and Rat.

Quick Overview for FLJ20674 (N-Term) antibody (ABIN636000)

Target: FLJ20674

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: FLJ20674 antibody was raised against the N terminal of FLJ20674

Purification: Affinity purified

Immunogen: FLJ20674 antibody was raised using the N terminal of FLJ20674 corresponding to a region with amino acids LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ20674 Blocking Peptide, (ABIN5613608), is also available for use as a blocking control in assays to test for specificity of this FLJ20674 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20674 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: FLJ20674

Background: The function of FLJ20674 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 59 kDa (MW of target protein)