UGT2A3 antibody (N-Term)

Catalog No. ABIN636014

The Rabbit Polyclonal anti-UGT2A3 antibody has been validated for WB. It is suitable to detect UGT2A3 in samples from Human.

Quick Overview for UGT2A3 antibody (N-Term) (ABIN636014)

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT2A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGT2A3 Antibody

Binding Specificity: N-Term

Specificity: UGT2 A3 antibody was raised against the N terminal of µgT2 3

Purification: Affinity purified

Immunogen: UGT2 A3 antibody was raised using the N terminal of µgT2 3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT2A3 Blocking Peptide, (ABIN5616902), is also available for use as a blocking control in assays to test for specificity of this µgT2A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT2A3

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Alternative Name: UGT2A3

Background: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis