Prolipoprotein Diacylglyceryl Transferase antibody (C-Term)

Catalog No. ABIN636039

This anti-Prolipoprotein Diacylglyceryl Transferase antibody is a Rabbit Polyclonal antibody detecting Prolipoprotein Diacylglyceryl Transferase in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Prolipoprotein Diacylglyceryl Transferase antibody (C-Term) (ABIN636039)

Target: Prolipoprotein Diacylglyceryl Transferase (IGT)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Prolipoprotein Diacylglyceryl Transferase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Prolipoprotein Diacylglyceryl Transferase Antibody

Binding Specificity: C-Term

Specificity: PIGT antibody was raised against the C terminal of PIGT

Purification: Affinity purified

Immunogen: PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGT Blocking Peptide, (ABIN5615371), is also available for use as a blocking control in assays to test for specificity of this PIGT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Prolipoprotein Diacylglyceryl Transferase

Target: Prolipoprotein Diacylglyceryl Transferase (IGT)

Alternative Name: IGT

Background: PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

Molecular Weight: 64 kDa (MW of target protein)