RHCE antibody (N-Term)

Catalog No. ABIN636066

This anti-RHCE antibody is a Rabbit Polyclonal antibody detecting RHCE in WB. Suitable for Human.

Quick Overview for RHCE antibody (N-Term) (ABIN636066)

Target: RHCE (Rhesus Blood Group, CcEe Antigens (RHCE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHCE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RHCE Antibody

Binding Specificity: N-Term

Specificity: RHCE antibody was raised against the N terminal of RHCE

Purification: Affinity purified

Immunogen: RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHCE Blocking Peptide, (ABIN5615855), is also available for use as a blocking control in assays to test for specificity of this RHCE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHCE

Target: RHCE (Rhesus Blood Group, CcEe Antigens (RHCE))

Alternative Name: RHCE

Background: The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.

Molecular Weight: 29 kDa (MW of target protein)