CYP4F3 antibody (N-Term)

Catalog No. ABIN636077

The Rabbit Polyclonal anti-CYP4F3 antibody has been validated for WB. It is suitable to detect CYP4F3 in samples from Human.

Quick Overview for CYP4F3 antibody (N-Term) (ABIN636077)

Target: CYP4F3 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 3 (CYP4F3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP4F3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CYP4F3 Antibody

Binding Specificity: N-Term

Specificity: CYP4 F3 antibody was raised against the N terminal of CYP4 3

Purification: Affinity purified

Immunogen: CYP4 F3 antibody was raised using the N terminal of CYP4 3 corresponding to a region with amino acids LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP4F3 Blocking Peptide, (ABIN940198), is also available for use as a blocking control in assays to test for specificity of this CYP4F3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP4F3

Target: CYP4F3 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 3 (CYP4F3))

Alternative Name: CYP4F3

Background: This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process