STS antibody

Catalog No. ABIN636085

This Rabbit Polyclonal antibody specifically detects STS in WB. It exhibits reactivity toward Human.

Quick Overview for STS antibody (ABIN636085)

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STS Antibody

Purification: Affinity purified

Immunogen: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STS Blocking Peptide, (ABIN938038), is also available for use as a blocking control in assays to test for specificity of this STS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STS

Target: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Alternative Name: STS

Background: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis