GSG1 antibody (C-Term)

Catalog No. ABIN636110

The Rabbit Polyclonal anti-GSG1 antibody has been validated for WB. It is suitable to detect GSG1 in samples from Human.

Quick Overview for GSG1 antibody (C-Term) (ABIN636110)

Target: GSG1 (Germ Cell Associated 1 (GSG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSG1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GSG1 Antibody

Binding Specificity: C-Term

Specificity: GSG1 antibody was raised against the C terminal of GSG1

Purification: Affinity purified

Immunogen: GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSG1 Blocking Peptide, (ABIN5613878), is also available for use as a blocking control in assays to test for specificity of this GSG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSG1

Target: GSG1 (Germ Cell Associated 1 (GSG1))

Alternative Name: GSG1

Background: GSG1 belongs to the GSG1 family. GSG1 may cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.

Molecular Weight: 36 kDa (MW of target protein)