UGT1A6 antibody (C-Term)

Catalog No. ABIN636119

The Rabbit Polyclonal anti-UGT1A6 antibody has been validated for WB. It is suitable to detect UGT1A6 in samples from Human, Mouse and Rat.

Quick Overview for UGT1A6 antibody (C-Term) (ABIN636119)

Target: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UGT1A6 Antibody

Binding Specificity: C-Term

Specificity: UGT1 A6 antibody was raised against the C terminal of µgT1 6

Purification: Affinity purified

Immunogen: UGT1 A6 antibody was raised using the C terminal of µgT1 6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A6 Blocking Peptide, (ABIN936810), is also available for use as a blocking control in assays to test for specificity of this µgT1A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A6

Target: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Alternative Name: UGT1A6

Background: UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha