TNFRSF21 antibody (N-Term)

Catalog No. ABIN636122

The Rabbit Polyclonal anti-TNFRSF21 antibody has been validated for WB. It is suitable to detect TNFRSF21 in samples from Human.

Quick Overview for TNFRSF21 antibody (N-Term) (ABIN636122)

Target: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFRSF21 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TNFRSF21 Antibody

Binding Specificity: N-Term

Specificity: TNFRSF21 antibody was raised against the N terminal of TNFRSF21

Purification: Affinity purified

Immunogen: TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNFRSF21 Blocking Peptide, (ABIN5616710), is also available for use as a blocking control in assays to test for specificity of this TNFRSF21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFRSF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNFRSF21

Target: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Alternative Name: TNFRSF21

Background: TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha