TNFRSF21 antibody (N-Term)
-
- Target See all TNFRSF21 Antibodies
- TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNFRSF21 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TNFRSF21 antibody was raised against the N terminal of TNFRSF21
- Purification
- Affinity purified
- Immunogen
- TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV
- Top Product
- Discover our top product TNFRSF21 Primary Antibody
-
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 406-605) antibody
TNFRSF21 Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 101-200) antibodyTNFRSF21 Reactivity: Mouse, Rat WB, ELISA, ICC, IHC (p), IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 356-385) antibodyTNFRSF21 Reactivity: Human WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 371-655) antibodyTNFRSF21 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 1-472) antibodyTNFRSF21 Reactivity: Human ELISA, IF Host: Mouse Monoclonal 1B1 unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 1-655) antibodyTNFRSF21 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 356-385) antibodyTNFRSF21 Reactivity: Human WB Host: Rabbit Polyclonal RB36664 unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 38-87) antibodyTNFRSF21 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 1-655) antibodyTNFRSF21 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (AA 1-124) antibodyTNFRSF21 Reactivity: Human ELISA Host: Mouse Monoclonal 1B2 unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNFRSF21 Blocking Peptide, catalog no. 33R-9334, is also available for use as a blocking control in assays to test for specificity of this TNFRSF21 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFRSF21 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))
- Alternative Name
- TNFRSF21 (TNFRSF21 Products)
- Background
- TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-
