DLG2 antibody (AA 336-379)

Catalog No. ABIN7043102

The Rabbit Polyclonal anti-DLG2 antibody has been validated for WB, IHC, IP, IF and IC. It is suitable to detect DLG2 in samples from Rat.

Quick Overview for DLG2 antibody (AA 336-379) (ABIN7043102)

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Reactivity: Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLG2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunofluorescence (IF), Immunochromatography (IC)

Grade: KO Validated

Product Details anti-DLG2 Antibody

Binding Specificity: AA 336-379

Purpose: A Rabbit Polyclonal Antibody to PSD-93

Specificity: Between PDZ2 and PDZ3 domains.

Cross-Reactivity: Mouse, Rat

Predicted Reactivity: Human - 42,44 amino acid residues identical

Characteristics: Anti- Antibody (ABIN7043102, ABIN7045142 and ABIN7045143) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize from rat, mouse, and human samples.

Purification: Affinity purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110

Isotype: IgG

Application Details

Application Notes:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A

Application Dilutions Western blot wb: 1:1000

Comment:

Negative Control: (ABIN7235223)

Blocking Peptide: (ABIN7235223)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW).

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Storage: 4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for DLG2

Target: DLG2 (Discs, Large Homolog 2 (DLG2))

Alternative Name: DLG2

Background: Discs large homolog 2, Dlg2, Chapsyn-110,Chapsyn 110 (also known as PSD-93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2.

Alternative names: PSD-93, Discs large homolog 2, Dlg2, Chapsyn-110

Gene ID: 64053

NCBI Accession: NM_001364

UniProt: Q63622