KCNA2 antibody (Intracellular)

Catalog No. ABIN7043517

Product Details anti-KCNA2 Antibody

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Binding Specificity: AA 417-499, Intracellular

Reactivity: Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNA2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunochromatography (IC)

Purpose: A Rabbit Polyclonal Antibody to KV1.2 (KCNA2) Channel

Specificity: Intracellular, C-terminus

Cross-Reactivity: Human, Mouse, Rat

Predicted Reactivity: Mouse,dog,human,- identical

Characteristics: Anti-Kv1.2 (KCNA2) Antibody is directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (ABIN7043517, ABIN7044912 and ABIN7044913) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2

Isotype: IgG

Application Details

Application Notes:

Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody

Application Dilutions Immunohistochemistry paraffin embedded sections ihc: 1:300

Application Dilutions Western blot wb: 1:200

Comment:

Cited Application: IP|IHC|ICC

Negative Control: (ABIN7236492)

Blocking Peptide: (ABIN7236492)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW).

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Storage: 4 °C,-20 °C

Storage Comment:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Target Details for KCNA2

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Alternative Name: KCNA2 (KCNA2 Products)

Background: Potassium voltage-gated channel subfamily A member 2, RBK2,KV1.2 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.2 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.2 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and cardiac and smooth muscle tissue as well as in retina and pancreas.2 The crystal structure of KV1.2 was recently solved shading light on the structure of a mammalian voltage dependent channel.3 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.KV1.2 channels are sensitive to high doses of TEA (560 mM) and low doses of 4-AP (0.59 mM), the "classical" non-selective potassium channel blockers.Several venomous toxins from snakes, scorpions and honey bee are potent blockers (affecting the channels in the nanomolar range) of KV1.2 channels. Among these, the most potent and selective are α-Dendrotoxin (1-12 nM), Dendrotoxin-I (0.13 nM), Maurotoxin (0.1-0.8 nM), Hongotoxin-1 (0.17 nM), Margatoxin (0.16-0.65 nM), Tityustoxin Kα (0.21 nM) and MCD peptide (10-400 nM).4

Alternative names: KV1.2 (KCNA2), Potassium voltage-gated channel subfamily A member 2, RBK2

Gene ID: 25468

NCBI Accession: NM_004974

UniProt: P63142