Kv1.4 antibody (Intracellular)
-
- Target See all Kv1.4 (KCNA4) Antibodies
- Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))
-
Binding Specificity
- AA 589-655, Intracellular
-
Reactivity
- Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Kv1.4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunochromatography (IC)
- Purpose
- A Rabbit Polyclonal Antibody to KV1.4 Channel
- Specificity
- Intracellular, C-terminus
- Cross-Reactivity
- Human, Mouse, Rat
- Predicted Reactivity
- Mouse - identical, human - 66,67 (or 65,67) amino acid residues identical, bovine - 64,67 amino acid residues identical
- Characteristics
- Anti-Kv1.4 Antibody is directed against an epitope of rat KV1.4. Anti-KV1.4 Antibody (ABIN7043525, ABIN7044908 and ABIN7044909) can be used in western blot, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.4 from human, rat and mouse samples.
- Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogen
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4
- Isotype
- IgG
- Top Product
- Discover our top product KCNA4 Primary Antibody
-
-
- Application Notes
-
Antigen preadsorption control: 3 μg fusion protein per 1 μg antibody
Application Dilutions Immunohistochemistry paraffin embedded sections ihc: N/A
Application Dilutions Western blot wb: 1:200
- Comment
-
Negative Control: (ABIN7236508)
Blocking Peptide: (ABIN7236508)
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- 0.2 mL double distilled water (DDW).
- Concentration
- 1 mg/mL
- Buffer
- PBS pH 7.4
- Storage
- 4 °C,-20 °C
- Storage Comment
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Target
- Kv1.4 (KCNA4) (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 4 (KCNA4))
- Alternative Name
- KCNA4 (KCNA4 Products)
- Background
-
Potassium voltage-gated channel subfamily A member 4, KCNA4,KV1.4 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.4 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition, several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.4 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the pancreas.2 The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.KV1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the "classical" non-selective potassium channel blockers.Most venomous peptide toxins that affect other KV channels do not inhibit KV1.4. However, the sea anemone toxin Stichodactyla Toxin (ShK), which is more potent towards KV1.1 and KV1.3, is still a potent inhibitor of KV1.4 channels.3
Alternative names: KV1.4, Potassium voltage-gated channel subfamily A member 4, KCNA4 - Gene ID
- 25469
- NCBI Accession
- NM_002233
- UniProt
- P15385
-