GDF9 antibody (C-Term)

Catalog No. ABIN7126467

The Mouse Monoclonal anti-GDF9 antibody has been validated for WB, ELISA, Coat and IHC (f). It is suitable to detect GDF9 in samples from Human.

Quick Overview for GDF9 antibody (C-Term) (ABIN7126467)

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This GDF9 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Coating (Coat), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))

Product Details anti-GDF9 Antibody

Binding Specificity: C-Term

Specificity: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.

Cross-Reactivity (Details): Human.

Purification: 1.0mg/ml of Ab purified from Bioreactor by Protein A/G.

Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.

Isotype: IgG1

Application Details

Application Notes:

Known_Application: ELISA (For coating, order antibody without BSA), Western Blot (1-2 μg/mL), ,Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT),(Staining of formalin-fixed tissues requires heating tissue sections in 10 mM Tris with 1 mM EDTA, pH 9.0, for 45 min at 95 °C followed by cooling at RT for 20 minutes),Optimal dilution for a specific application should be determined.

Positive_Control: Human ovary.

Restrictions: For Research Use only

Handling

Concentration: 1.0 mg/mL

Buffer: Prepared in 10 mM PBS, WITHOUT BSA and Azide.

Preservative: Azide free

Storage: -20 °C,-80 °C

Storage Comment: Antibody without azide - store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous.

Expiry Date: 24 months

Target Details for GDF9

Target: GDF9 (Growth Differentiation Factor 9 (GDF9))

Alternative Name: GDF9

Background: Growth/differentiation factor 9, GDF-9, GDF9,GDF9 (Growth Differentiation Factor 9)
Cellular localisation: Cytoplasmic (secreted)

Molecular Weight: 51kDa

Gene ID: 2661, 25022

UniProt: O60383