anti-Rat (Rattus) YWHAZ antibody for Immunohistochemistry

Recommended YWHAZ Antibody

Antigen
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
  • 14-3-3-zeta
  • KCIP-1
  • YWHAD
  • 14-3-3zeta
  • Ywhaz
  • ACYPI003154
  • 14-3-3z
  • kcip-1
  • ywhaq
  • 1433z
  • ywhaz
  • ywhazb
  • 1110013I11Rik
  • AI596267
  • AL022924
  • AU020854
  • ywhaza
  • fb14h09
  • wu:fb05g08
  • wu:fb14h09
  • ywhai
  • zgc:55807
  • 14-3-3
  • 14-3-3 zeta
  • 14-3-3ZETA
  • 14-3-3leo
  • 2G1
  • 4-3-3 zeta
  • 5.11
  • 549
  • BEST:GH05075
  • CG17870
  • D14-3-3
  • D14-3-3zeta
  • Dmel\\CG17870
  • K
  • LEO
  • Leo
  • PAR-5
  • PAR5
  • Par-5
  • d14-3-3zeta
  • l(2)07103
  • l(2)46CFe
  • l(2)46Ee
  • leo
  • par-5
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • 14-3-3 protein zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog
  • 14-3-3 protein zeta/delta pseudogene
  • CG17870 gene product from transcript CG17870-RE
  • YWHAZ
  • 14-3-3zeta
  • ywhaz
  • 1433z
  • ywhaz.L
  • Ywhaz
  • ywhaz.S
  • LOC100855903
Reactivity
Human, Mouse (Murine), Rat (Rattus)
243
172
145
25
24
20
19
11
7
7
6
6
4
3
2
2
1
1
Host
Rabbit
236
11
Clonality
Polyclonal
Conjugate
This YWHAZ antibody is un-conjugated
10
5
5
4
4
4
4
4
4
3
3
3
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
207
121
91
60
55
24
17
13
12
6
3
3
3
Options

Available images

Catalog No. ABIN5693157
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
22.03025 ABIN3183080 ELISA IF IHC IP WB Rabbit IgG Tyr330 Polyclonal 0
19.087353 ABIN6256377 ELISA ICC IF IHC WB Rabbit IgG pSer58 Polyclonal 0
19.03025 ABIN3182730 ELISA IF IHC WB Rabbit IgG pSer58 Polyclonal 0
17.53025 ABIN965482 IHC WB Rabbit Polyclonal 2
16.087353 ABIN1847200 ELISA IF/ICC IHC WB Rabbit pSer58 Polyclonal 0
16.03025 ABIN3183079 ELISA IHC WB Rabbit IgG Internal Region Polyclonal 0
13.087354 ABIN2704427 IC IF IHC WB Rabbit C-Term Polyclonal 0
13.087354 ABIN2705349 IC IF IP IHC WB Rabbit pSer58 Polyclonal 0
13.087354 ABIN2705350 IC IF IP IHC WB Rabbit Center Polyclonal 0
13.087354 ABIN1532187 ELISA IF IHC IP WB Rabbit IgG AA 24-73 Polyclonal 0
13.087354 ABIN1531170 IF IHC ELISA WB Rabbit IgG AA 24-73, pSer58 Polyclonal 0
13.087354 ABIN1870698 IF IHC WB Rabbit IgG pSer58 Polyclonal 0
13.087354 ABIN1574324 IF IHC ELISA WB Rabbit pSer58 Polyclonal 0
13.087354 ABIN1574326 IF IP IHC ELISA WB Rabbit IgG Ser58 Polyclonal 0
13.03025 ABIN1842501 IF IHC WB Rabbit IgG pSer58 Polyclonal 0
13.03025 ABIN2132649 IF IHC ELISA WB Rabbit IgG pSer58 Polyclonal 0
13.03025 ABIN965481 IHC Rabbit pSer58 0
10.087354 ABIN2783207 IHC WB Rabbit Middle Region Polyclonal 1
10.087354 ABIN2801375 IHC WB Rabbit C-Term, pThr232 Polyclonal 0
10.087354 ABIN1534158 IF IHC ELISA Rabbit IgG AA 1-50 Polyclonal 0

General

Antigen Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(243), (172), (145), (25), (24), (20), (19), (11), (7), (7), (6), (6), (4), (3), (2), (2), (1), (1)
Host Rabbit
(236), (11)
Clonality
Polyclonal
Conjugate This YWHAZ antibody is un-conjugated
(10), (5), (5), (4), (4), (4), (4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(207), (121), (91), (60), (55), (24), (17), (13), (12), (6), (3), (3), (3)
Supplier

Product Details anti-YWHAZ Antibody

Target Details YWHAZ Application Details Handling Images
Brand Picoband™
Sequence LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for 14-3-3 zeta/delta detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).

Target Details YWHAZ

Product Details anti-YWHAZ Antibody Application Details Handling Images back to top
Antigen
Alternative Name YWHAZ (YWHAZ Antibody Abstract)
Background

Synonyms: 14-3-3 protein zeta/delta, Protein kinase C inhibitor protein 1, KCIP-1, YWHAZ

Background: 14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt P63104
Pathways Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location

Application Details

Product Details anti-YWHAZ Antibody Target Details YWHAZ Handling Images back to top
Application Notes

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5&mu,g/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1&mu,g/mL

Restrictions For Research Use only

Handling

Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Handling back to top
Supplier Images
Image no. 1 for anti-Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . E...
Image no. 2 for anti-Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . E...
Image no. 3 for anti-Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...
Image no. 4 for anti-Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...
Image no. 5 for anti-Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...
Image no. 6 for anti-Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...