anti-Rat (Rattus) YWHAZ antibody for Immunohistochemistry

Recommended YWHAZ Antibody (supplied by: Log in to see )

Antigen
tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
  • 14-3-3-zeta
  • KCIP-1
  • YWHAD
  • 14-3-3zeta
  • Ywhaz
  • ACYPI003154
  • 14-3-3z
  • kcip-1
  • ywhaq
  • 1433z
  • ywhaz
  • ywhazb
  • 1110013I11Rik
  • AI596267
  • AL022924
  • AU020854
  • ywhaza
  • fb14h09
  • wu:fb05g08
  • wu:fb14h09
  • ywhai
  • zgc:55807
  • 14-3-3
  • 14-3-3 zeta
  • 14-3-3ZETA
  • 14-3-3leo
  • 2G1
  • 4-3-3 zeta
  • 5.11
  • 549
  • BEST:GH05075
  • CG17870
  • D14-3-3
  • D14-3-3zeta
  • Dmel\\CG17870
  • K
  • LEO
  • Leo
  • PAR-5
  • PAR5
  • Par-5
  • d14-3-3zeta
  • l(2)07103
  • l(2)46CFe
  • l(2)46Ee
  • leo
  • par-5
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  • 14-3-3 protein zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog
  • 14-3-3 protein zeta/delta pseudogene
  • CG17870 gene product from transcript CG17870-RE
  • YWHAZ
  • 14-3-3zeta
  • ywhaz
  • 1433z
  • ywhaz.L
  • Ywhaz
  • ywhaz.S
  • LOC100855903
Reactivity
Human, Mouse (Murine), Rat (Rattus)
243
171
135
29
24
21
20
15
7
7
6
6
4
4
3
3
2
2
1
Host
Rabbit
234
12
Clonality
Polyclonal
Conjugate
This YWHAZ antibody is un-conjugated
7
6
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
224
130
90
63
63
24
15
13
12
7
3
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN5693157
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
21.073498 ABIN3183080 ELISA IF IHC IP WB Rabbit IgG Tyr330 Log in to see Polyclonal 0
18.971891 ABIN6256377 ELISA ICC IF IHC WB Rabbit IgG pSer58 Log in to see Polyclonal 0
18.971891 ABIN6259641 ELISA ICC IF IHC IP WB Rabbit IgG Log in to see Polyclonal 0
18.073498 ABIN3182730 ELISA IF IHC WB Rabbit IgG pSer58 Log in to see Polyclonal 0
16.573498 ABIN965482 IHC WB Rabbit Log in to see Polyclonal 2
15.971891 ABIN1847200 ELISA IF/ICC IHC WB Rabbit pSer58 Log in to see Polyclonal 0
15.073499 ABIN3183079 ELISA IHC WB Rabbit IgG Internal Region Log in to see Polyclonal 0
12.971891 ABIN2704427 IC IF IHC WB Rabbit C-Term Log in to see Polyclonal 0
12.971891 ABIN2705350 IC IF IP IHC WB Rabbit Center Log in to see Polyclonal 0
12.971891 ABIN2705349 IC IF IP IHC WB Rabbit pSer58 Log in to see Polyclonal 0
12.971891 ABIN1532187 ELISA IF IHC IP WB Rabbit IgG AA 24-73 Log in to see Polyclonal 0
12.971891 ABIN1531170 IF IHC ELISA WB Rabbit IgG AA 24-73, pSer58 Log in to see Polyclonal 0
12.971891 ABIN1870698 IF IHC WB Rabbit IgG pSer58 Log in to see Polyclonal 0
12.971891 ABIN1491173 IHC IHC (p) WB Rabbit AA 200-245 Log in to see Polyclonal 0
12.971891 ABIN6580611 IF IP IHC ELISA WB Rabbit IgG Ser58 Log in to see Polyclonal 0
12.971891 ABIN6580610 IF IHC ELISA WB Rabbit pSer58 Log in to see Polyclonal 0
12.073499 ABIN1842501 IF IHC WB Rabbit IgG pSer58 Log in to see Polyclonal 0
12.073499 ABIN2132649 IF IHC ELISA WB Rabbit IgG pSer58 Log in to see Polyclonal 0
12.073499 ABIN965481 IHC Rabbit pSer58 Log in to see 0
10 ABIN2987574 IF/ICC IHC WB Rabbit IgG pSer58 Log in to see Polyclonal 0

General

Antigen tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(243), (171), (135), (29), (24), (21), (20), (15), (7), (7), (6), (6), (4), (4), (3), (3), (2), (2), (1)
Host Rabbit
(234), (12)
Clonality
Polyclonal
Conjugate This YWHAZ antibody is un-conjugated
(7), (6), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(224), (130), (90), (63), (63), (24), (15), (13), (12), (7), (3), (3)
Supplier Log in to see

Product Details anti-YWHAZ Antibody

Target Details YWHAZ Application Details Handling Images
Brand Picoband™
Sequence LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for 14-3-3 zeta/delta detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
Plasmids, Primers & others

Target Details YWHAZ

Product Details anti-YWHAZ Antibody Application Details Handling Images back to top
Antigen
Alternative Name YWHAZ (YWHAZ Antibody Abstract)
Background

Synonyms: 14-3-3 protein zeta/delta, Protein kinase C inhibitor protein 1, KCIP-1, YWHAZ

Background: 14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt P63104
Pathways Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location

Application Details

Product Details anti-YWHAZ Antibody Target Details YWHAZ Handling Images back to top
Application Notes

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5&mu,g/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1&mu,g/mL

Restrictions For Research Use only

Handling

Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Images

Product Details anti-YWHAZ Antibody Target Details YWHAZ Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . E...
Western Blotting (WB) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) Western blot analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . E...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...
Immunohistochemistry (IHC) image for anti-tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide (YWHAZ) antibody (ABIN5693157) IHC analysis of 14-3-3 zeta/delta using anti-14-3-3 zeta/delta antibody . 14-3-3 zeta...