ENO2/NSE Protein (AA 2-285) (His tag)
-
- Target See all ENO2/NSE (ENO2) Proteins
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Protein Type
- Recombinant
- Protein Characteristics
- AA 2-285
-
Origin
- Human
-
Source
- Escherichia coli (E. coli)
- Purification tag / Conjugate
- This ENO2/NSE protein is labelled with His tag.
- Application
- Western Blotting (WB), SDS-PAGE (SDS), Immunogen (Imm), Positive Control (PC)
- Sequence
- Ser2-Leu285+TILWSPLRTH LTRMIGLPGP SSQPCRDPDC GVMT
- Characteristics
- Recombinant Enolase, Neuron Specific (NSE), Prokaryotic expression, Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT, N-terminal His Tag
- Purity
- > 97 %
- Top Product
- Discover our top product ENO2 Protein
-
Want other Options for this Protein ?
!Discover Our Predefined Custom Proteins and Custom Protein Services!Your project requires further customization? Contact us and discover our custom protein solutions
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Isoelectric Point:5.1
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Buffer
- PBS, pH 7.4, containing 0.01 % SKL, 1 mM DTT, 5 % Trehalose and Proclin300.
- Preservative
- ProClin
- Precaution of Use
- This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-80 °C
- Storage Comment
- Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
- Expiry Date
- 12 months
-
- Target
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Alternative Name
- Enolase, Neuron Specific (ENO2 Products)
- Background
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
- UniProt
- P09104
-